Lynx rufus (bobcat): 124523768 Help Entry 124523768         CDS       T08475                                  Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism lruf  Lynx rufus (bobcat) Pathway lruf04140   Autophagy - animal lruf04144   Endocytosis lruf04152   AMPK signaling pathway lruf04530   Tight junction lruf04972   Pancreatic secretion lruf05014   Amyotrophic lateral sclerosis lruf05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:lruf00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     124523768  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     124523768    04140 Autophagy - animal     124523768   09144 Cellular community - eukaryotes    04530 Tight junction     124523768  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     124523768  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     124523768    05022 Pathways of neurodegeneration - multiple diseases     124523768  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lruf04131]     124523768    03036 Chromosome and associated proteins [BR:lruf03036]     124523768   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lruf04147]     124523768    04031 GTP-binding proteins [BR:lruf04031]     124523768 Membrane trafficking [BR:lruf04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     124523768  Autophagy   Other autophagy associated proteins     124523768 Chromosome and associated proteins [BR:lruf03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     124523768 Exosome [BR:lruf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124523768   Exosomal proteins of other body fluids (saliva and urine)    124523768   Exosomal proteins of colorectal cancer cells    124523768 GTP-binding proteins [BR:lruf04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     124523768 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 DUF3963 Septin AAA_7 Motif Other DBs NCBI-GeneID:  124523768 NCBI-ProteinID:  XP_046951603 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSSQGVKITPDQQKRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgcgttcaactcaactttcatctccacc ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaagctacag atatgggacacagctggtcaggaacggtttcggacgatcacaacggcctactacaggggc gcaatgggcatcatgctggtctatgacatcaccaacgagaaatcctttgacaacatccgg aactggattcggaatattgaggagcatgcttctgcagatgtcgaaaagatgatactcggg aacaagtgtgacgtgaacgacaagagacaagtgtccaaggaacggggagagaagctcgcc ctggactatggaatcaagttcatggagaccagtgcgaaggccaacatcaacgtggagaat gcatttttcactctcgccagagacatcaaagcaaaaatggacaaaaaactggaaggcaac agcccccaagggagcagccagggagtcaaaatcaccccagaccagcagaagagaagcagc tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system