Lynx rufus (bobcat): 124523904 Help Entry 124523904         CDS       T08475                                  Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism lruf  Lynx rufus (bobcat) Pathway lruf04014   Ras signaling pathway lruf04015   Rap1 signaling pathway lruf04022   cGMP-PKG signaling pathway lruf04024   cAMP signaling pathway lruf04062   Chemokine signaling pathway lruf04071   Sphingolipid signaling pathway lruf04072   Phospholipase D signaling pathway lruf04081   Hormone signaling lruf04144   Endocytosis lruf04150   mTOR signaling pathway lruf04270   Vascular smooth muscle contraction lruf04310   Wnt signaling pathway lruf04350   TGF-beta signaling pathway lruf04360   Axon guidance lruf04510   Focal adhesion lruf04520   Adherens junction lruf04530   Tight junction lruf04611   Platelet activation lruf04621   NOD-like receptor signaling pathway lruf04625   C-type lectin receptor signaling pathway lruf04660   T cell receptor signaling pathway lruf04670   Leukocyte transendothelial migration lruf04722   Neurotrophin signaling pathway lruf04810   Regulation of actin cytoskeleton lruf04921   Oxytocin signaling pathway lruf04928   Parathyroid hormone synthesis, secretion and action lruf04972   Pancreatic secretion lruf05100   Bacterial invasion of epithelial cells lruf05132   Salmonella infection lruf05133   Pertussis lruf05135   Yersinia infection lruf05152   Tuberculosis lruf05163   Human cytomegalovirus infection lruf05200   Pathways in cancer lruf05203   Viral carcinogenesis lruf05205   Proteoglycans in cancer lruf05206   MicroRNAs in cancer lruf05210   Colorectal cancer lruf05417   Lipid and atherosclerosis lruf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:lruf00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     124523904    04015 Rap1 signaling pathway     124523904    04310 Wnt signaling pathway     124523904    04350 TGF-beta signaling pathway     124523904    04072 Phospholipase D signaling pathway     124523904    04071 Sphingolipid signaling pathway     124523904    04024 cAMP signaling pathway     124523904    04022 cGMP-PKG signaling pathway     124523904    04150 mTOR signaling pathway     124523904   09133 Signaling molecules and interaction    04081 Hormone signaling     124523904  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     124523904   09144 Cellular community - eukaryotes    04510 Focal adhesion     124523904    04520 Adherens junction     124523904    04530 Tight junction     124523904   09142 Cell motility    04810 Regulation of actin cytoskeleton     124523904  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     124523904    04621 NOD-like receptor signaling pathway     124523904    04625 C-type lectin receptor signaling pathway     124523904    04660 T cell receptor signaling pathway     124523904    04670 Leukocyte transendothelial migration     124523904    04062 Chemokine signaling pathway     124523904   09152 Endocrine system    04921 Oxytocin signaling pathway     124523904    04928 Parathyroid hormone synthesis, secretion and action     124523904   09153 Circulatory system    04270 Vascular smooth muscle contraction     124523904   09154 Digestive system    04972 Pancreatic secretion     124523904   09156 Nervous system    04722 Neurotrophin signaling pathway     124523904   09158 Development and regeneration    04360 Axon guidance     124523904  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     124523904    05206 MicroRNAs in cancer     124523904    05205 Proteoglycans in cancer     124523904    05203 Viral carcinogenesis     124523904   09162 Cancer: specific types    05210 Colorectal cancer     124523904   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     124523904   09171 Infectious disease: bacterial    05132 Salmonella infection     124523904    05135 Yersinia infection     124523904    05133 Pertussis     124523904    05152 Tuberculosis     124523904    05100 Bacterial invasion of epithelial cells     124523904   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     124523904    05418 Fluid shear stress and atherosclerosis     124523904  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lruf04131]     124523904   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lruf04147]     124523904    04031 GTP-binding proteins [BR:lruf04031]     124523904 Membrane trafficking [BR:lruf04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     124523904 Exosome [BR:lruf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124523904   Exosomal proteins of other body fluids (saliva and urine)    124523904   Exosomal proteins of colorectal cancer cells    124523904   Exosomal proteins of bladder cancer cells    124523904 GTP-binding proteins [BR:lruf04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     124523904 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  124523904 NCBI-ProteinID:  XP_046951793 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggcaagacttgc ttgctcatcgtcttcagcaaggaccagttcccagaggtgtatgtacccacagtgtttgag aactatgtggcagatattgaagttgatggaaagcaggtagagttggctttgtgggataca gctgggcaggaagattatgatcgcttgaggcctctctcctatccggacactgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact ccggaagtcaagcacttctgtcccaatgtgcccatcattctggttggaaacaagaaggat cttcggaatgatgagcacacaaggcgggagctggccaagatgaagcaggagccggtgaaa ccagaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagccgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system