Lynx rufus (bobcat): 124525697 Help Entry 124525697         CDS       T08475                                  Name (RefSeq) interferon alpha   KO K05414   interferon alpha Organism lruf  Lynx rufus (bobcat) Pathway lruf04060   Cytokine-cytokine receptor interaction lruf04151   PI3K-Akt signaling pathway lruf04217   Necroptosis lruf04620   Toll-like receptor signaling pathway lruf04621   NOD-like receptor signaling pathway lruf04622   RIG-I-like receptor signaling pathway lruf04623   Cytosolic DNA-sensing pathway lruf04630   JAK-STAT signaling pathway lruf04650   Natural killer cell mediated cytotoxicity lruf04936   Alcoholic liver disease lruf05152   Tuberculosis lruf05160   Hepatitis C lruf05161   Hepatitis B lruf05162   Measles lruf05163   Human cytomegalovirus infection lruf05164   Influenza A lruf05165   Human papillomavirus infection lruf05167   Kaposi sarcoma-associated herpesvirus infection lruf05168   Herpes simplex virus 1 infection lruf05169   Epstein-Barr virus infection lruf05170   Human immunodeficiency virus 1 infection lruf05171   Coronavirus disease - COVID-19 lruf05200   Pathways in cancer lruf05320   Autoimmune thyroid disease lruf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:lruf00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     124525697    04151 PI3K-Akt signaling pathway     124525697   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     124525697  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     124525697  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     124525697    04621 NOD-like receptor signaling pathway     124525697    04622 RIG-I-like receptor signaling pathway     124525697    04623 Cytosolic DNA-sensing pathway     124525697    04650 Natural killer cell mediated cytotoxicity     124525697  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     124525697   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     124525697    05161 Hepatitis B     124525697    05160 Hepatitis C     124525697    05171 Coronavirus disease - COVID-19     124525697    05164 Influenza A     124525697    05162 Measles     124525697    05168 Herpes simplex virus 1 infection     124525697    05163 Human cytomegalovirus infection     124525697    05167 Kaposi sarcoma-associated herpesvirus infection     124525697    05169 Epstein-Barr virus infection     124525697    05165 Human papillomavirus infection     124525697   09171 Infectious disease: bacterial    05152 Tuberculosis     124525697   09163 Immune disease    05320 Autoimmune thyroid disease     124525697   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     124525697   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     124525697  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lruf04052]     124525697 Cytokines and neuropeptides [BR:lruf04052]  Cytokines   Interferons    124525697 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  124525697 NCBI-ProteinID:  XP_046954218 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MALPSSFLVALVALGCNSICSLGCDLPQTHGLLNRRALTLLGQMRRLPASSCQKDRNDFA FPQDVFGGEQSHKAQALSVVHATNQKIFHFFCTEASSSAAWNTTLLEEFCTGLDRQLTRL EACVVQEVGEGEAPLTNEDSILRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLYYSSTA LQKRLRSEK NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggcgctgccctcttccttcttggtggccctggtggcgctgggctgcaactccatctgc tctctgggctgtgacctgcctcagacccacggcctgctgaacaggagggccttgacgctc ctgggacaaatgaggagactccctgccagctcctgccagaaggacagaaatgacttcgcc ttcccccaggacgtgtttggtggagagcagtcccacaaggcccaagccctctctgtggtg cacgcgacgaaccagaagatcttccacttcttctgcacagaggcgtcctcgtctgctgct tggaacaccaccctcctggaggaattctgcacgggacttgatcggcagctgacccgcctg gaagcctgtgtcgtgcaggaggtgggggagggagaggctcccctcacgaacgaggactcc atcctgaggaactacttccaaagactctccctctacctgcaagagaagaaatacagccct tgtgcctgggagatcgtcagagcagaaatcatgagatccttgtattattcatcaacagcc ttgcagaaaagattaaggagcgagaaatga

DBGET integrated database retrieval system