Lynx rufus (bobcat): 124526101 Help Entry 124526101         CDS       T08475                                  Name (RefSeq) somatostatin   KO K05237   somatostatin Organism lruf  Lynx rufus (bobcat) Pathway lruf04024   cAMP signaling pathway lruf04080   Neuroactive ligand-receptor interaction lruf04081   Hormone signaling lruf04935   Growth hormone synthesis, secretion and action lruf04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:lruf00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     124526101   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     124526101    04081 Hormone signaling     124526101  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     124526101   09154 Digestive system    04971 Gastric acid secretion     124526101  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lruf04052]     124526101 Cytokines and neuropeptides [BR:lruf04052]  Neuropeptides   GPCR binding    124526101 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  124526101 NCBI-ProteinID:  XP_046954799 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSTNSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtgcgcgctggccgcgctgtccatcgtcctggctctgggc ggtgtcaccggcgcgccctccgatcctcgactccgtcagtttctgcagaagtccctggct gctgccgcggggaagcaggaactggccaagtacttcttggcagagctgctgtctgaaccc aaccagacagagaacgatgccctggaacccgaagacttgtcccaggcggctgagcaggat gaaatgaggctggaactgcagagatccactaactcaaaccctgccatggcaccccgagaa cgcaaagctggctgcaagaatttcttctggaagactttcacttcctgttag

DBGET integrated database retrieval system