Lynx rufus (bobcat): 124528465 Help Entry 124528465         CDS       T08475                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism lruf  Lynx rufus (bobcat) Pathway lruf04613   Neutrophil extracellular trap formation lruf05034   Alcoholism lruf05202   Transcriptional misregulation in cancer lruf05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:lruf00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     124528465  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     124528465   09163 Immune disease    05322 Systemic lupus erythematosus     124528465   09165 Substance dependence    05034 Alcoholism     124528465  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lruf03036]     124528465   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lruf04147]     124528465 Chromosome and associated proteins [BR:lruf03036]  Eukaryotic type   Nucleosome assembly factors    Histones     124528465 Exosome [BR:lruf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124528465 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  124528465 NCBI-ProteinID:  XP_046958053 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacgaagcagacggcgcgcaagtcgacgggcggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccaccggcggcgtcaagaagccgcac cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccaccgag ctgctcatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgcatccgtggggagcgggcataa

DBGET integrated database retrieval system