Lynx rufus (bobcat): 124528503 Help Entry 124528503         CDS       T08475                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism lruf  Lynx rufus (bobcat) Pathway lruf04613   Neutrophil extracellular trap formation lruf05034   Alcoholism lruf05203   Viral carcinogenesis lruf05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:lruf00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     124528503  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     124528503   09163 Immune disease    05322 Systemic lupus erythematosus     124528503   09165 Substance dependence    05034 Alcoholism     124528503  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lruf03036]     124528503 Chromosome and associated proteins [BR:lruf03036]  Eukaryotic type   Nucleosome assembly factors    Histones     124528503 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  124528503 NCBI-ProteinID:  XP_046958094 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaaaggcgggaagggcctgggcaaggggggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcacgaagcccgccatccggcggctggcccgg cgcggcggcgtgaagcgcatctccggcctcatctacgaggagacgcgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtgtacgcgctcaagcgccagggccgcaccctctacggc ttcgggggctaa

DBGET integrated database retrieval system