Luteibacter rhizovicinus DSM 16549: BJI69_01165 Help Entry BJI69_01165       CDS       T04563                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lrz  Luteibacter rhizovicinus DSM 16549 Pathway lrz01100   Metabolic pathways lrz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lrz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BJI69_01165    00074 Mycolic acid biosynthesis     BJI69_01165   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BJI69_01165 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  APG02652 UniProt:  A0A0G9HFS4 LinkDB All DBs Position 233132..233401 Genome browser AA seq 89 aa AA seqDB search MNDLERDIAGLIIETLALDHLKVDDITVDQPLFGQGLGLDSVDALELALALQQRYGLKIA SDSRDARRHFETVSSLAHYVEANRAPCAS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaacgacctcgaacgggatatcgccggactcatcatcgaaaccctcgccctcgaccac ctgaaagtggacgacatcaccgtggaccaacccttgttcggccaggggctcggtctggac tcggtcgatgcgctggaactcgccctcgcgctgcaacagcgttacggcctgaaaatcgcc tcggattcgcgtgacgcgcggcgtcatttcgaaacggtgtcgagcctcgcccactacgtc gaagcgaaccgggccccatgcgcaagctga

DBGET integrated database retrieval system