Luteibacter rhizovicinus DSM 16549: BJI69_21445 Help Entry BJI69_21445       CDS       T04563                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lrz  Luteibacter rhizovicinus DSM 16549 Pathway lrz01100   Metabolic pathways lrz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lrz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BJI69_21445    00074 Mycolic acid biosynthesis     BJI69_21445   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BJI69_21445 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C HLH Ribosomal_L50 DUF1896 Motif Other DBs NCBI-ProteinID:  APG06216 UniProt:  A0A0G9H886 LinkDB All DBs Position complement(4717272..4717511) Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVVEQLGVKEDEVTTNASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITTVQQAVDYIKAHVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgttaagaagatcgtcgtcgagcagctgggcgtcaaggaa gatgaagtcaccaccaacgcgtcgttcgtggacgatctgggcgccgattcgctggatacc gttgagctcgtgatggctctcgaagaagagttcgagtgcgaaatcccggacgaagaagct gagaagatcacgacggttcagcaggcggtcgactacatcaaggcccacgtcaaggcctga

DBGET integrated database retrieval system