KEGG   Loktanella salsilacus: KBK07_00665
Entry
KBK07_00665       CDS       T08282                                 
Symbol
rnc
Name
(GenBank) ribonuclease III
  KO
K03685  ribonuclease III [EC:3.1.26.3]
Organism
lsal  Loktanella salsilacus
Brite
KEGG Orthology (KO) [BR:lsal00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    KBK07_00665 (rnc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lsal03019]
    KBK07_00665 (rnc)
   03009 Ribosome biogenesis [BR:lsal03009]
    KBK07_00665 (rnc)
   03036 Chromosome and associated proteins [BR:lsal03036]
    KBK07_00665 (rnc)
Enzymes [BR:lsal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.3  ribonuclease III
     KBK07_00665 (rnc)
Messenger RNA biogenesis [BR:lsal03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     KBK07_00665 (rnc)
Ribosome biogenesis [BR:lsal03009]
 Eukaryotic type
  90S particles
   RNase
    KBK07_00665 (rnc)
 Prokaryotic type
  rRNA processing factors
   KBK07_00665 (rnc)
Chromosome and associated proteins [BR:lsal03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Microprocessor complex
     KBK07_00665 (rnc)
SSDB
Motif
Pfam: Ribonucleas_3_3 Ribonuclease_3 dsrm RM44_endonuclase DND1_DSRM DUF6204
Other DBs
NCBI-ProteinID: UTH44645
LinkDB
Position
133315..133995
AA seq 226 aa
MKLSVQLTGFAARVGHDFADPALLVRAVTHSSMSSVHRDDNQRLEFLGDRVLGLVIAEAL
LQADPGAAEGLLAPRYNALVRRETCADVAREIGLGEVLKLGRSEMQSGGRRKEALLADAM
EAVIAAVYYDAGYDAARKVILKHWQPRVGSVAADARDAKTALQEWAQGRGAPPPVYTEVA
RTGPDHQPVFTIRVTLESGEHAEATAGAKRQAEQAAAQALLERVGQ
NT seq 681 nt   +upstreamnt  +downstreamnt
gtgaagctatcagtacaattgacgggctttgccgcccgcgtgggtcacgactttgccgac
ccagctcttttggtgcgcgcggtaacgcattccagcatgtcgagcgtgcaccgcgacgac
aaccagcgactagagtttttgggtgaccgagtccttggactcgtgattgccgaagcatta
ttgcaggctgatccgggcgctgccgaagggctgcttgctccgcgctacaacgccttggtg
cgccgcgaaacctgcgccgatgtagcgcgggaaatcgggctgggcgaggtgttaaagctg
ggccggtctgaaatgcaatccggcgggcgccgcaaagaagctttgctggctgatgcgatg
gaagcggtgattgctgcggtttactacgacgccggctatgatgccgcgcgcaaagtgatc
ctaaagcactggcagccgcgtgttggcagcgttgccgcagatgcgcgcgacgccaagacg
gcgctgcaggaatgggcgcaggggcgcggtgcgccgccgccggtttataccgaagttgcg
cgcacaggaccggatcatcagccggttttcacaattcgtgttacactagagtccggcgaa
catgccgaggcgaccgccggggccaagcggcaggcggaacaagcagcggcgcaagccctg
ctcgaaagggtcggacaatga

DBGET integrated database retrieval system