Littorina saxatilis: 138956654 Help Entry 138956654         CDS       T10665                                  Name (RefSeq) cysteine dioxygenase type 1-like   KO K00456   cysteine dioxygenase [EC:1.13.11.20] Organism lsax  Littorina saxatilis Pathway lsax00270   Cysteine and methionine metabolism lsax00430   Taurine and hypotaurine metabolism lsax01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:lsax00001]  09100 Metabolism   09105 Amino acid metabolism    00270 Cysteine and methionine metabolism     138956654   09106 Metabolism of other amino acids    00430 Taurine and hypotaurine metabolism     138956654 Enzymes [BR:lsax01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.20  cysteine dioxygenase      138956654 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CDO_I Motif Other DBs NCBI-GeneID:  138956654 NCBI-ProteinID:  XP_070184056 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MYEWPDHLLAAHEQTGRTDIPADDAQFGQMKMRDDHCYGRDKCTYICDDIGLHRVENPSH TDKSVTLHLYSPPFDECLCFDERTGRPITSQVTFWSKFGKRTPFGKDPKLVSAGEKENN NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgtacgagtggccggaccacctgttggctgcccacgagcagacgggacgcactgacatt ccggccgacgatgcccagttcggacagatgaagatgcgagatgaccactgctacgggagg gacaagtgtacctacatctgtgacgacataggcttgcaccgagtggagaaccccagtcac acggacaagtccgtgacccttcacctctacagtccccctttcgacgagtgtctgtgtttc gacgagcggaccggtcgccctatcacgtcgcaagtcaccttctggagcaagttcggcaag agaacaccatttggaaaggaccccaagcttgtcagcgcaggcgaaaaagaaaacaactaa

DBGET integrated database retrieval system