Littorina saxatilis: 138961486 Help Entry 138961486         CDS       T10665                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism lsax  Littorina saxatilis Pathway lsax04814   Motor proteins Brite KEGG Orthology (KO) [BR:lsax00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     138961486  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:lsax03037]     138961486    04812 Cytoskeleton proteins [BR:lsax04812]     138961486 Cilium and associated proteins [BR:lsax03037]  Motile cilia and associated proteins   Dynein arm    138961486 Cytoskeleton proteins [BR:lsax04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      138961486 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 PTP2 MCEL_GT_NTPase HinfI DUF3231 Motif Other DBs NCBI-GeneID:  138961486 NCBI-ProteinID:  XP_070189240 LinkDB All DBs Position LG3:complement(6811937..6825020) Genome browser AA seq 113 aa AA seqDB search MDDFQSGEETAFVVDEVTNIIKEAVEGSIGGNAYQHNKVNQWTSSVVEQCLNQLTKLSKP FKYIVTCVIMQKNGAGLHTASSCYWDNQTDGSCTVRWENKTMYCIVSVFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggatgatttccagtctggagaggagacggcgttcgttgtcgatgaggtcactaacatc atcaaggaggcagtggaggggtccattgggggcaacgcctatcagcacaacaaggtgaac cagtggacgtccagtgtggtggagcagtgtctcaaccagctcacaaaactcagcaagccc ttcaagtacatcgtgacttgcgtcatcatgcagaaaaacggtgccggtctgcacacggcc agctcctgttactgggacaatcagactgatggaagctgcacagtacgatgggagaacaag accatgtactgcattgtgagcgtcttcggccttgctatctag

DBGET integrated database retrieval system