KEGG   Littorina saxatilis: 138971096
Entry
138971096         CDS       T10665                                 
Name
(RefSeq) S-phase kinase-associated protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
lsax  Littorina saxatilis
Pathway
lsax03083  Polycomb repressive complex
lsax04120  Ubiquitin mediated proteolysis
lsax04141  Protein processing in endoplasmic reticulum
lsax04310  Wnt signaling pathway
lsax04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:lsax00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    138971096
   04120 Ubiquitin mediated proteolysis
    138971096
  09126 Chromosome
   03083 Polycomb repressive complex
    138971096
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    138971096
   04350 TGF-beta signaling pathway
    138971096
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lsax04131]
    138971096
   04121 Ubiquitin system [BR:lsax04121]
    138971096
   03036 Chromosome and associated proteins [BR:lsax03036]
    138971096
Membrane trafficking [BR:lsax04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    138971096
Ubiquitin system [BR:lsax04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     138971096
   Cul7 complex
     138971096
Chromosome and associated proteins [BR:lsax03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     138971096
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     138971096
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 138971096
NCBI-ProteinID: XP_070199808
LinkDB
Position
LG7:28739221..28741385
AA seq 162 aa
MPSMKLQSSDGEMFEVDVEIAKQSVTIKTMLEDLGMDDDEEEAVPLPNVNAAILKKVIQW
CTYHKDDPPPPEDDENKEKRTDDICSWDAEFLKVDQGTLFELILAANYLDIKGLLDVTCK
TVANMIKGKSPEEIRKTFNIKNDFTPAEEEQVRKENEWCEEK
NT seq 489 nt   +upstreamnt  +downstreamnt
atgccttccatgaagctgcagagctcggacggggagatgttcgaggtggatgtcgagatc
gccaagcagtctgtcacaatcaaaactatgttggaggatcttggtatggatgatgatgag
gaagaagcggtccccctgcccaacgtgaacgcagccatcctgaagaaggtgatacagtgg
tgcacctaccacaaggatgaccccccaccgcccgaggacgatgagaacaaggagaagagg
accgacgacatctgttcctgggacgctgaattcctcaaggtcgaccagggcaccctcttt
gaactcattctggcggccaactacctggacattaagggtctgctggacgttacctgcaag
accgtggccaacatgatcaaaggcaagtcacctgaggagatccgcaagacctttaacatc
aagaatgacttcacccccgctgaggaggaacaggtgcgaaaagaaaacgagtggtgcgag
gagaagtaa

DBGET integrated database retrieval system