Leptodesmis sichuanensis: KIK02_07055 Help Entry KIK02_07055       CDS       T07779                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism lsc  Leptodesmis sichuanensis Brite KEGG Orthology (KO) [BR:lsc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:lsc03032]     KIK02_07055    03036 Chromosome and associated proteins [BR:lsc03036]     KIK02_07055    03400 DNA repair and recombination proteins [BR:lsc03400]     KIK02_07055 DNA replication proteins [BR:lsc03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     KIK02_07055 Chromosome and associated proteins [BR:lsc03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     KIK02_07055 DNA repair and recombination proteins [BR:lsc03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       KIK02_07055 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 VWA_3 DUF2267 Motif Other DBs NCBI-ProteinID:  UIE39327 LinkDB All DBs Position 1500826..1501128 Genome browser AA seq 100 aa AA seqDB search MNKGELVDAVADKASVTKKQADAVLSAALEAIVEAVSSGDKVTLVGFGSFEPRERKAREG RNPKTGDKMNIPATKVPAFSAGKLFKEKVAPPEGAAGKKK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaggcgaattagttgatgctgttgcagacaaggcaagcgtaactaagaagcaa gcagatgctgtattgtcggctgctttagaagcgatcgtggaagcggtcagtagtggagac aaagtgacactggttggctttggttcctttgaaccgagggaacggaaagcccgcgaagga cgtaatccaaaaactggcgataagatgaatatcccagcgacaaaagttcctgcattttct gctggaaaactgtttaaagaaaaggttgcgcctcccgaaggtgctgctggtaagaaaaag tag

DBGET integrated database retrieval system