Agrilutibacter solisilvae: I8J32_016675 Help Entry I8J32_016675      CDS       T10348                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism lsf  Agrilutibacter solisilvae Brite KEGG Orthology (KO) [BR:lsf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:lsf03032]     I8J32_016675    03036 Chromosome and associated proteins [BR:lsf03036]     I8J32_016675    03400 DNA repair and recombination proteins [BR:lsf03400]     I8J32_016675 DNA replication proteins [BR:lsf03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     I8J32_016675 Chromosome and associated proteins [BR:lsf03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     I8J32_016675 DNA repair and recombination proteins [BR:lsf03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       I8J32_016675 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_bac_2 DUF2267 HU-CCDC81_euk_1 VWA_3 HU-DNA_bdg YmgD Motif Other DBs NCBI-ProteinID:  QSX78280 UniProt:  A0A975AST2 LinkDB All DBs Position complement(3761841..3762113) Genome browser AA seq 90 aa AA seqDB search MNKADFVAAVAEAAELSKTDAANAVDAVISVITKSLKKGDTVTLVGFGTFQVRERAARQG RNPKTGETIKIKKSKNPAFKAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaggccgactttgtagccgccgtcgccgaggccgcggaactgtccaagaccgac gccgccaacgccgtcgacgcggtgatcagcgtcatcaccaagtcgctcaagaagggcgat accgtgacgctggtcgggttcggcaccttccaggtgcgtgagcgcgccgcccgccagggt cgcaatcccaagaccggcgaaacgatcaagatcaagaagtcgaagaaccctgcgttcaag gccggcaaggcgctcaaggatgcggtcaactga

DBGET integrated database retrieval system