Legionella sainthelensi: CAB17_15800 Help Entry CAB17_15800       CDS       T05293                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism lsh  Legionella sainthelensi Brite KEGG Orthology (KO) [BR:lsh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lsh03036]     CAB17_15800 (ftsB) Chromosome and associated proteins [BR:lsh03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     CAB17_15800 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC CENP-H DUF848 ZapB Motif Other DBs NCBI-ProteinID:  AUH73356 UniProt:  A0A0W0YPC8 LinkDB All DBs Position 2067382..2067651 Genome browser AA seq 89 aa AA seqDB search MRPLFIILIVSLVILQHKLWLGDGNLIQWRELQKKLAAHEQENNKLATRNRSLEADIKEL KNGDQALEEQARFELGMIKENEVYYHFID NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgcgtccactgtttattattttgattgtttcgttggttattttgcagcataaattatgg ctgggcgatggtaatttgattcaatggcgtgaacttcaaaaaaaacttgctgctcatgaa caagaaaacaataagttagcaactcgtaatcgctcccttgaagcagacataaaagaactt aaaaatggtgatcaagctttagaagagcaagcacgatttgagctagggatgatcaaagag aatgaagtctattatcattttattgattga

DBGET integrated database retrieval system