Leptidea sinapis (Wood White): 126965094 Help Entry 126965094         CDS       T09272                                  Name (RefSeq) histone H2B-like   KO K11252   histone H2B Organism lsin  Leptidea sinapis (Wood White) Brite KEGG Orthology (KO) [BR:lsin00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lsin03036]     126965094   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lsin04147]     126965094 Chromosome and associated proteins [BR:lsin03036]  Eukaryotic type   Nucleosome assembly factors    Histones     126965094 Exosome [BR:lsin04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    126965094 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like CENP-T_C DUF1931 Motif Other DBs NCBI-GeneID:  126965094 NCBI-ProteinID:  XP_050664518 LinkDB All DBs Position 1:complement(32602783..32603963) Genome browser AA seq 107 aa AA seqDB search MHKPLYFSCRIYYEVYVACIIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEAS RLAHYNKRSTITSREVQTSVRLLLPGELAKHAVSEGTKAVTKYTSSK NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgcataagccactgtatttctcctgtagaatttactacgaagtatacgttgcgtgtata atatacatctacaaagtgctcaagcaggtgcacccggacaccggtatctcgtcgaaggcc atgtccatcatgaactctttcgtgaacgacatcttcgaacgtatcgcggccgaggcgtcc cgtcttgcgcactacaacaagcgttccacgatcacatcccgggaggtgcagacgagcgtg aggctcctgctgcccggtgagctggccaagcacgcggtcagcgagggcaccaaggcggtg accaagtacacgagctcgaagtga

DBGET integrated database retrieval system