Leptidea sinapis (Wood White): 126965333 Help Entry 126965333         CDS       T09272                                  Name (RefSeq) GTPase HRas   KO K07827   GTPase KRas Organism lsin  Leptidea sinapis (Wood White) Pathway lsin04013   MAPK signaling pathway - fly lsin04068   FoxO signaling pathway lsin04137   Mitophagy - animal lsin04140   Autophagy - animal lsin04150   mTOR signaling pathway lsin04213   Longevity regulating pathway - multiple species lsin04214   Apoptosis - fly lsin04320   Dorso-ventral axis formation Brite KEGG Orthology (KO) [BR:lsin00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     126965333    04068 FoxO signaling pathway     126965333    04150 mTOR signaling pathway     126965333  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     126965333    04137 Mitophagy - animal     126965333   09143 Cell growth and death    04214 Apoptosis - fly     126965333  09150 Organismal Systems   09158 Development and regeneration    04320 Dorso-ventral axis formation     126965333   09149 Aging    04213 Longevity regulating pathway - multiple species     126965333  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lsin04131]     126965333   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:lsin04031]     126965333 Membrane trafficking [BR:lsin04131]  Endocytosis   Macropinocytosis    Ras GTPases     126965333 GTP-binding proteins [BR:lsin04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     126965333 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Motif Other DBs NCBI-GeneID:  126965333 NCBI-ProteinID:  XP_050664834 EnsemblRapid:  ENSLSNG00005018370 LinkDB All DBs Position 7:complement(15225087..15237456) Genome browser AA seq 191 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGSYREQIKRVKDAEEVPMVLVGNKCDL QAWAVDMTQAREVARSYGVPFVETSAKTRMGVDDAFYTLVREIRKDKESRGKKYRRGHKL GSRRTFKCTLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgaccgaatacaagctagtagtggtaggcgctggaggcgtgggaaagtctgcattgacc atacagttgatacagaaccatttcgtcgacgagtacgatcctacaatcgaagattcatac agaaagcaggtagtgattgatggtgagacgtgcctcttagatatcttggacactgctggt caagaggagtactctgctatgagagaccagtatatgcggacaggagaaggattcttgctt gttttcgctgtgaacagtgcaaagagtttcgaagatattggttcatatagggaacaaata aaacgagtaaaggatgctgaggaagtacctatggtgttagttgggaacaagtgtgacttg caggcctgggctgtggatatgacacaagcacgagaggtggcaagaagttatggagtacca tttgtagaaacatcagccaagacccgcatgggagtcgacgacgcgttctacactctggtc cgagaaatacgcaaggataaggaaagtaggggaaagaagtacaggaggggtcacaaactg ggatccaggcggacttttaaatgtacattattgtaa

DBGET integrated database retrieval system