Leptidea sinapis (Wood White): 126967259 Help Entry 126967259         CDS       T09272                                  Name (RefSeq) insulin-related peptide 2   KO K04526   insulin Organism lsin  Leptidea sinapis (Wood White) Pathway lsin04068   FoxO signaling pathway lsin04081   Hormone signaling lsin04140   Autophagy - animal lsin04150   mTOR signaling pathway lsin04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:lsin00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     126967259    04150 mTOR signaling pathway     126967259   09133 Signaling molecules and interaction    04081 Hormone signaling     126967259  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     126967259  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     126967259  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lsin04052]     126967259 Cytokines and neuropeptides [BR:lsin04052]  Neuropeptides   Unclassified    126967259 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  126967259 NCBI-ProteinID:  XP_050667706 LinkDB All DBs Position 12:5254879..5256984 Genome browser AA seq 101 aa AA seqDB search MKFLVVLACALAFVAAEKEKPVVLCGRQLANARVLICYGAEYIMKRASPENLLDDDKWLG EWIWRGRQGAISADWTRYKRDGLADECCLRPCTTEVILKYC NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgaagtttcttgtggttttggcttgtgcactggcatttgtggctgctgagaaagaaaag ccagtagtgttatgtggccggcaactagcaaatgcgagggttttaatatgttatggagct gagtacatcatgaaaagggcttcacctgaaaacttactcgacgacgataaatggctggga gagtggatttggagaggtcgccaaggtgccataagtgcggactggacaagatataagcgc gacggtttagctgacgagtgttgcttacggccttgcaccacagaagttatacttaaatac tgctga

DBGET integrated database retrieval system