Leptidea sinapis (Wood White): 126974394 Help Entry 126974394         CDS       T09272                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism lsin  Leptidea sinapis (Wood White) Pathway lsin04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:lsin00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     126974394  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:lsin04121]     126974394    03400 DNA repair and recombination proteins [BR:lsin03400]     126974394 Ubiquitin system [BR:lsin04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      126974394    Cul5 complex      126974394 DNA repair and recombination proteins [BR:lsin03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      126974394 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  126974394 NCBI-ProteinID:  XP_050677830 LinkDB All DBs Position 32:1682939..1693634 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRKKLTIFTDAKDTTTVLELKKMIEGILKVPPPSQMLFNKDSQLMEDERTLAE YGLTSVTAKAQCPAPIGLALRKENGEFEALDLTPYSSPPDLPDVMKSQETNGQEQMDQH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtctttttaatgattaggcggaaaaagttaaccatcttcacagatgcaaaagat actacaactgtattggaattgaagaaaatgattgaaggtatacttaaggtcccaccacca agtcaaatgttgttcaacaaagacagtcaacttatggaggatgaaaggaccctggcggaa tatggtttgacctctgtaacagctaaagcacaatgcccggcaccaattggacttgcttta aggaaagaaaatggcgaatttgaagcattggatctgacaccatattcatccccacccgat ctaccagatgtgatgaaatcacaggaaaccaatggacaggaacagatggatcaacactaa

DBGET integrated database retrieval system