Leptidea sinapis (Wood White): 126977031 Help Entry 126977031         CDS       T09272                                  Name (RefSeq) bombyxin A-1 homolog   KO K04526   insulin Organism lsin  Leptidea sinapis (Wood White) Pathway lsin04068   FoxO signaling pathway lsin04081   Hormone signaling lsin04140   Autophagy - animal lsin04150   mTOR signaling pathway lsin04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:lsin00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     126977031    04150 mTOR signaling pathway     126977031   09133 Signaling molecules and interaction    04081 Hormone signaling     126977031  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     126977031  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     126977031  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lsin04052]     126977031 Cytokines and neuropeptides [BR:lsin04052]  Neuropeptides   Unclassified    126977031 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  126977031 NCBI-ProteinID:  XP_050681644 LinkDB All DBs Position 43:complement(5252720..5256202) Genome browser AA seq 117 aa AA seqDB search MQFKVAIVVLVALVSTCCCHIGGGFALQDTAPQVYCGRTLARALALLCFDEPMSEKRDGG SMYNSILPPYYKEQDNPLGWPLVTPHKAHGLSRGKRQFVVSECCDKPCSINELLSYC NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgcagttcaaagtagcaattgttgtgctggtggcgctagtgtccacgtgctgttgccac atcggcggtggatttgctctacaagatacggctccccaggtctactgcggcagaacttta gcgagggctctggcgttactttgctttgatgaaccgatgtcagagaagcgggacggagga tctatgtataattcaatcctcccaccttactacaaggagcaggacaatccgctaggttgg ccactggtaactcctcacaaggcccatggattatcccggggaaaacgacaatttgtcgtc agtgaatgctgtgataagccttgcagtataaacgaactcctatcttattgttaa

DBGET integrated database retrieval system