Leptothermofonsia sichuanensis: J5X98_20945 Help Entry J5X98_20945       CDS       T07904                                  Name (GenBank) RNA-binding protein hfq   KO K03666   host factor-I protein Organism lsk  Leptothermofonsia sichuanensis Pathway lsk02024   Quorum sensing lsk03018   RNA degradation Brite KEGG Orthology (KO) [BR:lsk00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     J5X98_20945  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     J5X98_20945  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:lsk03019]     J5X98_20945    03036 Chromosome and associated proteins [BR:lsk03036]     J5X98_20945 Messenger RNA biogenesis [BR:lsk03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      J5X98_20945 Chromosome and associated proteins [BR:lsk03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     J5X98_20945 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq_1 Hfq DUF695 Motif Other DBs NCBI-ProteinID:  QZZ19760 LinkDB All DBs Position 4880220..4880435 Genome browser AA seq 71 aa AA seqDB search MTVEFETGLPSVRQIQNMIREEKEVELKLTTGDLLAGKISWQDPHCISLTDQYDQPTIVW RQAIVYLKPRM NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgactgtagaatttgaaaccggattacccagtgtccgccagattcaaaacatgattcga gaagagaaagaggttgaacttaaactgaccactggcgatctgctagctggcaagatcagt tggcaggacccccattgtatttctcttacggaccagtatgatcagcccacgattgtttgg cgacaggctattgtttacttgaaacccaggatgtag

DBGET integrated database retrieval system