Lepeophtheirus salmonis (salmon louse): 121117174 Help Entry 121117174         CDS       T08214                                  Symbol Rab7 Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism lsm  Lepeophtheirus salmonis (salmon louse) Pathway lsm04137   Mitophagy - animal lsm04140   Autophagy - animal lsm04144   Endocytosis lsm04145   Phagosome lsm04148   Efferocytosis Brite KEGG Orthology (KO) [BR:lsm00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     121117174 (Rab7)    04145 Phagosome     121117174 (Rab7)    04140 Autophagy - animal     121117174 (Rab7)    04137 Mitophagy - animal     121117174 (Rab7)    04148 Efferocytosis     121117174 (Rab7)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lsm04131]     121117174 (Rab7)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lsm04147]     121117174 (Rab7)    04031 GTP-binding proteins [BR:lsm04031]     121117174 (Rab7) Membrane trafficking [BR:lsm04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     121117174 (Rab7) Exosome [BR:lsm04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121117174 (Rab7)   Exosomal proteins of other body fluids (saliva and urine)    121117174 (Rab7)   Exosomal proteins of colorectal cancer cells    121117174 (Rab7)   Exosomal proteins of bladder cancer cells    121117174 (Rab7) GTP-binding proteins [BR:lsm04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     121117174 (Rab7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA cobW ATP_bind_1 nSTAND3 AAA_16 Septin AAA_7 NTPase_1 PduV-EutP AAA_24 AAA_22 G-alpha ATPase_2 AAA_5 NB-ARC NACHT AAA_14 MCM ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  121117174 NCBI-ProteinID:  XP_040567443 UniProt:  A0A0K2TCG7 LinkDB All DBs Position 5:13175710..13177124 Genome browser AA seq 205 aa AA seqDB search MTSSKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDQLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLCYDVTDANTFQSLESWRDEFLIQASPSDLDNFPF VVLGNKVDLENRAVSSKRAQQWCHSKNEVPYFETSAKEAINVEQAFLTIAKNALAQDTED NFLDHFPEQIRLTNSVDEERSSCAC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgacatccagtaagaaggttctattaaaagtcatcattttgggggactctggagttggg aagacctctcttatgaatcagtatgtcaataaaaaattttcaaatcaatataaagcgaca attggagcggattttctgaccaaagaggtcatggtagatgatcaactcgttacgatgcaa atctgggacacagctggacaagagcgattccaatcccttggtgttgctttttatcgtgga gctgactgttgtgtattgtgctacgatgtcacagacgccaataccttccaatctctggaa agttggagggatgagtttctcattcaggcttccccttcagacctagacaatttccctttt gttgttttagggaacaaagtggatttagaaaatcgggctgtatcaagcaaacgtgctcaa caatggtgtcacagcaaaaatgaagtaccttattttgagacatcggcaaaggaagctatc aacgttgaacaagcattcttaaccatcgcaaagaatgctctcgcccaagatactgaagat aactttctcgatcatttcccggaacaaattcgactaactaattctgttgacgaagaaagg agttcatgtgcttgctga

DBGET integrated database retrieval system