Lepeophtheirus salmonis (salmon louse): 121117787 Help Entry 121117787         CDS       T08214                                  Name (RefSeq) uncharacterized protein   KO K04513   Ras homolog gene family, member A Organism lsm  Lepeophtheirus salmonis (salmon louse) Pathway lsm04081   Hormone signaling lsm04144   Endocytosis lsm04150   mTOR signaling pathway lsm04310   Wnt signaling pathway lsm04350   TGF-beta signaling pathway lsm05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:lsm00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     121117787    04350 TGF-beta signaling pathway     121117787    04150 mTOR signaling pathway     121117787   09133 Signaling molecules and interaction    04081 Hormone signaling     121117787  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     121117787  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     121117787  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lsm04131]     121117787   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lsm04147]     121117787    04031 GTP-binding proteins [BR:lsm04031]     121117787 Membrane trafficking [BR:lsm04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     121117787 Exosome [BR:lsm04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121117787   Exosomal proteins of other body fluids (saliva and urine)    121117787   Exosomal proteins of colorectal cancer cells    121117787   Exosomal proteins of bladder cancer cells    121117787 GTP-binding proteins [BR:lsm04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     121117787 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf PduV-EutP RsgA_GTPase GTP_EFTU SRPRB Gtr1_RagA Motif Other DBs NCBI-GeneID:  121117787 NCBI-ProteinID:  XP_040568214 LinkDB All DBs Position 5:43212715..43214762 Genome browser AA seq 183 aa AA seqDB search MNSRNSVKRYKLVVVGDGACGKTSLLTVFKTGIFPKSEYVPTVFESDIAYMNVDNVDIEL SLWDTAGQEFYDRLRILTYPADVIIICFAIDRPETLANVRKRWIPEVRQHCKGVPILLVG NKIDLRDDRMVLSNLRKVQKAPVLFAETRSMAYSINATAFHECSAKLLDGVNELFFNGSK SCN NT seq 552 nt NT seq  +upstreamnt  +downstreamnt atgaattcaagaaattctgttaaacgctataaactggtggtggtcggtgatggagcttgt ggaaaaacgagtttgctaactgtctttaaaacagggatatttccaaaaagtgaatacgtt ccgactgtttttgaatctgatattgcttacatgaatgttgataacgttgacatagagttg tctttatgggatactgcaggtcaagaattttatgatcgacttcgtatattaacatatcct gctgatgtaatcatcatttgttttgcaattgatcgtccagagactttagctaatgtacgg aaacgatggataccagaggtgagacagcattgcaaaggagtacccatacttctggtggga aataagattgatctcagggatgatcgcatggttttatctaatttgagaaaagttcaaaaa gctccagtattatttgctgagactagatcaatggcttatagcatcaacgcaacagcattt catgagtgttcagcaaaactattggatggtgtgaatgaacttttttttaatggcagcaaa agctgcaattag

DBGET integrated database retrieval system