Lepeophtheirus salmonis (salmon louse): 121126976 Help Entry 121126976         CDS       T08214                                  Symbol Cdc42 Name (RefSeq) cdc42 homolog   KO K04393   cell division control protein 42 Organism lsm  Lepeophtheirus salmonis (salmon louse) Pathway lsm04144   Endocytosis lsm05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:lsm00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     121126976 (Cdc42)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     121126976 (Cdc42)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lsm04131]     121126976 (Cdc42)    03036 Chromosome and associated proteins [BR:lsm03036]     121126976 (Cdc42)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lsm04147]     121126976 (Cdc42)    04031 GTP-binding proteins [BR:lsm04031]     121126976 (Cdc42) Membrane trafficking [BR:lsm04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     121126976 (Cdc42)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     121126976 (Cdc42)   Macropinocytosis    Ras GTPases     121126976 (Cdc42) Chromosome and associated proteins [BR:lsm03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     121126976 (Cdc42) Exosome [BR:lsm04147]  Exosomal proteins   Exosomal proteins of microglial cells    121126976 (Cdc42)   Exosomal proteins of breast milk    121126976 (Cdc42) GTP-binding proteins [BR:lsm04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     121126976 (Cdc42) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  121126976 NCBI-ProteinID:  XP_040578265 LinkDB All DBs Position 12:2211531..2215600 Genome browser AA seq 159 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCYSVVSPSSYENVREKWVPEISHHCQRTPFLLVGTQIDLR DEAATIEKLTKNKQKPLSMEVGEKLAKELKAVRYVECSA NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgcaaacgattaagtgtgtggtggtgggcgatggagccgtgggtaagacgtgcctcctc atttcctacacgacgaacaagtttccgtccgagtacgttccaacagtgtttgacaattat gcagtgacagtgatgattgggggcgagccctacactttgggcctgtttgatacagcgggg caagaggactatgatcggctgcgtcccctgagctacccgcagacggatgtgttcttggtg tgctactccgtcgtgtctccctcctcttacgaaaacgtgagggaaaagtgggtcccggag atctcgcaccactgtcaaaggacgcctttccttctcgtgggaactcagatcgacctgcgg gatgaggcggccacgatcgagaagctgacgaagaacaagcagaagcccttgagcatggaa gtgggagaaaagttggccaaggagctgaaggcggtacgctacgtggaatgctccgcttaa

DBGET integrated database retrieval system