Lysobacter soli: GOY17_12615 Help Entry GOY17_12615       CDS       T06337                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lsol  Lysobacter soli Pathway lsol01100   Metabolic pathways lsol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lsol00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GOY17_12615 (acpP)    00074 Mycolic acid biosynthesis     GOY17_12615 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GOY17_12615 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  QGW65679 LinkDB All DBs Position complement(2774499..2774738) Genome browser AA seq 79 aa AA seqDB search MSSIEERVKKIVVEQLGVKEEEVTNNASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITSVQQAIDYVKAHVKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcagcatcgaagaacgcgtcaagaagatcgtggtcgaacagcttggcgttaaggaa gaagaagtcaccaacaacgcttcgttcgtcgacgacctcggcgcggactcgctcgacacc gtcgagctggtgatggcgctcgaagaagagttcgagtgcgagatcccggacgaagaggcc gagaagatcacctcggtgcagcaggcgatcgactacgtgaaggctcacgtcaagagctaa

DBGET integrated database retrieval system