Lysinibacillus sphaericus: Bsph_2960 Help Entry Bsph_2960         CDS       T00656                                  Name (GenBank) acyl carrier protein   KO K24111   aryl carrier protein AsbD Organism lsp  Lysinibacillus sphaericus Pathway lsp00975   Biosynthesis of various siderophores lsp01100   Metabolic pathways lsp01110   Biosynthesis of secondary metabolites Module lsp_M01060   Petrobactin biosynthesis, spermidine => petrobactin Brite KEGG Orthology (KO) [BR:lsp00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00975 Biosynthesis of various siderophores     Bsph_2960  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:lsp01008]     Bsph_2960 Polyketide biosynthesis proteins [BR:lsp01008]  Nonribosomal peptide synthetase (NRPS)   Nonlinear NRPS    Petrobacin synthetase     Bsph_2960 SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ACA40489 LinkDB All DBs Position complement(2920752..2920970) Genome browser AA seq 72 aa AA seqDB search MENSLELQTLSSFNEDARLNEDLYMDSIMVLQLILHIELDLGISIPDEGLVPKDFKTVGT LASFLEEQQKID NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggaaaattcattagagttgcagacactgtcttcttttaatgaagatgcccgattaaat gaggatttatatatggattcaattatggttcttcaactcatccttcatatagaattggat cttggcatttccattcccgatgaggggctcgttccgaaagatttcaaaacagtagggaca ctagcaagcttcttagaagaacagcaaaagatagattaa

DBGET integrated database retrieval system