Lonchura striata (white-rumped munia): 110468670 Help Entry 110468670         CDS       T05897                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism lsr  Lonchura striata (white-rumped munia) Pathway lsr04010   MAPK signaling pathway lsr04068   FoxO signaling pathway lsr04081   Hormone signaling lsr04114   Oocyte meiosis lsr04140   Autophagy - animal lsr04150   mTOR signaling pathway lsr04810   Regulation of actin cytoskeleton lsr04910   Insulin signaling pathway lsr04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:lsr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110468670 (INS)    04068 FoxO signaling pathway     110468670 (INS)    04150 mTOR signaling pathway     110468670 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     110468670 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     110468670 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     110468670 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     110468670 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     110468670 (INS)    04914 Progesterone-mediated oocyte maturation     110468670 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lsr04052]     110468670 (INS) Cytokines and neuropeptides [BR:lsr04052]  Neuropeptides   Unclassified    110468670 (INS) SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  110468670 NCBI-ProteinID:  XP_021382452 UniProt:  A0A218USS7 LinkDB All DBs Position 5:complement(46803542..46806685) Genome browser AA seq 107 aa AA seqDB search MALWIRSLPLLALLAVSSPGSSHGAVNQHLCGSHLVEALYLVCGERGFFYQPKARRDVEQ PLVSGPLHGELGELPFQQEEFEKVKRGIVEQCCHNTCSLYQLENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggctctctggatccgatcactgcctctcctggccctcctggccgtctccagccccggg agcagccacggggctgtcaaccagcacctctgcggctcccacttggtggaagctctgtac ctggtgtgtggggagcggggcttcttctaccaacccaaagcccggcgggatgttgagcag cctctagtgagcggtcccttgcatggtgagctgggagagctgcccttccagcaggaggag tttgagaaggtgaagcgagggatcgttgagcaatgctgccacaacacctgctccctctac cagctggaaaactactgcaactag

DBGET integrated database retrieval system