Lonchura striata (white-rumped munia): 110470131 Help Entry 110470131         CDS       T05897                                  Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism lsr  Lonchura striata (white-rumped munia) Pathway lsr04060   Cytokine-cytokine receptor interaction lsr04218   Cellular senescence lsr04620   Toll-like receptor signaling pathway lsr04621   NOD-like receptor signaling pathway lsr04622   RIG-I-like receptor signaling pathway lsr05132   Salmonella infection lsr05164   Influenza A Brite KEGG Orthology (KO) [BR:lsr00001]  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110470131  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     110470131  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lsr04052]     110470131    00536 Glycosaminoglycan binding proteins [BR:lsr00536]     110470131 Cytokines and neuropeptides [BR:lsr04052]  Cytokines   Chemokines    110470131 Glycosaminoglycan binding proteins [BR:lsr00536]  Heparan sulfate / Heparin   Chemokines    110470131 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Ig_J_chain bPH_6 Motif Other DBs NCBI-GeneID:  110470131 NCBI-ProteinID:  XP_021385204 LinkDB All DBs Position 4:3786006..3788611 Genome browser AA seq 103 aa AA seqDB search MNGKLAAILALFLISAAVSQGRTLARMGTELRCQCIATHSRFIPPKSIQDVKLTQSGPHC KNVEVIATLKDGREVCLEPTAPWVQLIVKAILAKAEQNSDSPL NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaacgggaaactcgcagctatcctggctcttttccttatctcagcagctgtgtctcaa ggtaggaccctggcaaggatgggaaccgagctccggtgccagtgcatagccactcattcc agattcattcccccaaaatccatccaagatgtgaagctgacacagagcggcccccactgc aagaatgttgaagtcatagctactctgaaggatggcagagaggtgtgcttggagcccact gctccctgggtacagctgattgtaaaggcaattttggccaaggctgaacaaaattccgac tctcctctctaa

DBGET integrated database retrieval system