Lonchura striata (white-rumped munia): 110470724 Help Entry 110470724         CDS       T05897                                  Symbol FIS1 Name (RefSeq) mitochondrial fission 1 protein   KO K17969   mitochondrial fission 1 protein Organism lsr  Lonchura striata (white-rumped munia) Pathway lsr04137   Mitophagy - animal Brite KEGG Orthology (KO) [BR:lsr00001]  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     110470724 (FIS1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:lsr03029]     110470724 (FIS1) Mitochondrial biogenesis [BR:lsr03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     110470724 (FIS1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fis1_TPR_C TPR_2 TPR_14 TPR_19 TPR_P4H TPR_16 TPR_6 TPR_9 DUF3040 ANAPC3 TPR_1 TPR_11 ARM_TT21_N TPR_7 TPR-S Alkyl_sulf_dimr NatA_aux_su TPR_10 Motif Other DBs NCBI-GeneID:  110470724 NCBI-ProteinID:  XP_021386258 LinkDB All DBs Position Unknown AA seq 85 aa AA seqDB search LLPETPPQEQRDVLFYLALGYYRLKEYERSLELLERLLAAEPQNAQVQRLRGRVRNQLRR DGLVGAAIVGGVVVGVAGLLGVAIA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt agctgctccccgagacgcccccgcaggagcagcgcgacgtcctcttctacctggccctgg gctactaccggctcaaggagtacgagcgctcgctggagctcctggagcgcctcctggcgg ccgagccgcagaacgcgcaggtgcagcggctgcggggccgcgtcaggaaccaactgagga gagacgggctggtgggcgcggccatcgtggggggcgtggtcgtgggcgtggccgggctgc tgggcgtggccatcgcgc

DBGET integrated database retrieval system