Lonchura striata (white-rumped munia): 110470958 Help Entry 110470958         CDS       T05897                                  Name (RefSeq) calmodulin, striated muscle   KO K02183   calmodulin Organism lsr  Lonchura striata (white-rumped munia) Pathway lsr04020   Calcium signaling pathway lsr04070   Phosphatidylinositol signaling system lsr04114   Oocyte meiosis lsr04218   Cellular senescence lsr04261   Adrenergic signaling in cardiomyocytes lsr04270   Vascular smooth muscle contraction lsr04371   Apelin signaling pathway lsr04625   C-type lectin receptor signaling pathway lsr04744   Phototransduction lsr04910   Insulin signaling pathway lsr04912   GnRH signaling pathway lsr04916   Melanogenesis Brite KEGG Orthology (KO) [BR:lsr00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     110470958    04020 Calcium signaling pathway     110470958    04070 Phosphatidylinositol signaling system     110470958  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     110470958    04218 Cellular senescence     110470958  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     110470958   09152 Endocrine system    04910 Insulin signaling pathway     110470958    04912 GnRH signaling pathway     110470958    04916 Melanogenesis     110470958   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     110470958    04270 Vascular smooth muscle contraction     110470958   09157 Sensory system    04744 Phototransduction     110470958  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:lsr01009]     110470958   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lsr04131]     110470958    03036 Chromosome and associated proteins [BR:lsr03036]     110470958   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lsr04147]     110470958 Protein phosphatases and associated proteins [BR:lsr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      110470958 Membrane trafficking [BR:lsr04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     110470958 Chromosome and associated proteins [BR:lsr03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      110470958 Exosome [BR:lsr04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    110470958 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF_EFCAB10_C EH UPF0154 SPARC_Ca_bdg EFhand_Ca_insen Dockerin_1 EF-hand_11 Caleosin FCaBP_EF-hand DUF5580_M Motif Other DBs NCBI-GeneID:  110470958 NCBI-ProteinID:  XP_021386721 LinkDB All DBs Position 1A:complement(1793924..1794881) Genome browser AA seq 149 aa AA seqDB search MAERLSEEKIAEFKEAFSLFDRDGDGRITTKELGTVMRSLGQNPSEAELRDMVGEVDADG SGAVDFAEFLSLMARKTRDTDGEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDD EVDEMIREADCNDDGQVNYEEFVRMMTEK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgagcggctgtcggaggagaagatcgccgagttcaaggaggcgttctccctcttc gaccgcgacggcgacggccgcatcaccaccaaggagctgggcaccgtcatgcgctcgctg ggccagaaccccagcgaggccgagctgcgggacatggtgggcgaggtggacgccgacggc agcggcgccgtcgacttcgccgagttcctgtcgctgatggccaggaagacgagggacacg gacggcgaggaggagatccgcgaggcgttccgcgtcttcgacaaggacggcaacggctac atcagcgccgccgagctgcggcacgtcatgaccaacctgggcgagaagctgacggacgac gaggtggacgagatgatcagggaggccgactgcaacgacgacggccaggtcaactacgag gagttcgtgaggatgatgacggagaagtga

DBGET integrated database retrieval system