Lonchura striata (white-rumped munia): 110472026 Help Entry 110472026         CDS       T05897                                  Symbol BRK1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism lsr  Lonchura striata (white-rumped munia) Pathway lsr04810   Regulation of actin cytoskeleton lsr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lsr00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     110472026 (BRK1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110472026 (BRK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind LXG Motif Other DBs NCBI-GeneID:  110472026 NCBI-ProteinID:  XP_021388892 LinkDB All DBs Position 12:6784513..6785050 Genome browser AA seq 75 aa AA seqDB search MSVQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtcggtgcaggaggacccggtgcagcgggagatccaccaggactgggccaaccgcgag tacatcgaggtgatcaccagctccatcaagaaaatcgcggacttcctcaactctttcgac atgtcgtgccggtcccggctggccaccctcaacgagaagctgacggcgctggagcggaga atcgagtacatcgaagcccgggtcaccaagggagagacgctgacatag

DBGET integrated database retrieval system