Lonchura striata (white-rumped munia): 110472209 Help Entry 110472209         CDS       T05897                                  Symbol POLE3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism lsr  Lonchura striata (white-rumped munia) Pathway lsr03030   DNA replication lsr03082   ATP-dependent chromatin remodeling lsr03410   Base excision repair lsr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:lsr00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     110472209 (POLE3)    03410 Base excision repair     110472209 (POLE3)    03420 Nucleotide excision repair     110472209 (POLE3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     110472209 (POLE3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:lsr03032]     110472209 (POLE3)    03036 Chromosome and associated proteins [BR:lsr03036]     110472209 (POLE3)    03400 DNA repair and recombination proteins [BR:lsr03400]     110472209 (POLE3) Enzymes [BR:lsr01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      110472209 (POLE3) DNA replication proteins [BR:lsr03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     110472209 (POLE3) Chromosome and associated proteins [BR:lsr03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     110472209 (POLE3) DNA repair and recombination proteins [BR:lsr03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       110472209 (POLE3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone BUD22 CENP-T_C SpoU_methylase CIS_TMP RNA_pol_3_Rpc31 DUF4746 CDC45 Astro_capsid_p NOA36 PFF1_TM PBP_sp32 Motif Other DBs NCBI-GeneID:  110472209 NCBI-ProteinID:  XP_021389383 UniProt:  A0A218UM06 LinkDB All DBs Position 17:complement(5414406..5417197) Genome browser AA seq 143 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPEGVNISKEARSAISRAASVFVLYATSCANNFAMKGK RKTLNAGDVLSAMEEMEFQRFVAPLKESLEVYRREQKGKKEARKDKDKKADSEEQDKSRE EDNDEDDERMEEEEQNDEEEVDN NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atggcggagagaccggaggacctgaacctgcccaacgccgtcatcacccgcatcatcaag gaggcgcttcctgagggagtcaatatttccaaagaagcccggagcgcgatctcccgagca gcaagtgtgtttgtgctgtatgcaacatcatgtgcaaataactttgccatgaaggggaag aggaaaaccctgaatgctggggacgtgctttctgccatggaggagatggagttccagaga ttcgtggcccctctgaaggaatccctggaagtttacaggcgtgagcagaaaggaaagaaa gaggccaggaaagataaagacaagaaggcagactcggaggagcaagataagagccgagag gaggacaatgatgaggatgatgaaaggatggaggaggaagaacaaaacgatgaggaagag gtggataactga

DBGET integrated database retrieval system