Lonchura striata (white-rumped munia): 110473024 Help Entry 110473024         CDS       T05897                                  Name (RefSeq) metallothionein-1   KO K14739   metallothionein 1/2 Organism lsr  Lonchura striata (white-rumped munia) Brite KEGG Orthology (KO) [BR:lsr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:lsr03019]     110473024    03029 Mitochondrial biogenesis [BR:lsr03029]     110473024 Messenger RNA biogenesis [BR:lsr03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      110473024 Mitochondrial biogenesis [BR:lsr03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     110473024 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  110473024 NCBI-ProteinID:  XP_021390930 LinkDB All DBs Position 11:complement(8420140..8421542) Genome browser AA seq 63 aa AA seqDB search MDSQDCPCATGGTCTCGDNCKCKNCKCTSCKKGCCSCCPAGCAKCAQGCVCKGPPSAKCS CCK NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atggactctcaggattgtccttgtgccacaggtggcacctgcacctgcggggacaactgt aaatgcaaaaactgcaaatgcacatcgtgcaaaaaaggctgctgctcctgctgcccagct ggatgtgccaagtgtgcacagggctgtgtctgcaaggggcccccctccgccaagtgcagc tgctgcaaatag

DBGET integrated database retrieval system