Lonchura striata (white-rumped munia): 110473049 Help Entry 110473049         CDS       T05897                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism lsr  Lonchura striata (white-rumped munia) Pathway lsr04010   MAPK signaling pathway lsr04012   ErbB signaling pathway lsr04068   FoxO signaling pathway lsr04137   Mitophagy - animal lsr04140   Autophagy - animal lsr04150   mTOR signaling pathway lsr04210   Apoptosis lsr04218   Cellular senescence lsr04370   VEGF signaling pathway lsr04371   Apelin signaling pathway lsr04540   Gap junction lsr04625   C-type lectin receptor signaling pathway lsr04810   Regulation of actin cytoskeleton lsr04910   Insulin signaling pathway lsr04912   GnRH signaling pathway lsr04916   Melanogenesis Brite KEGG Orthology (KO) [BR:lsr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110473049 (NRAS)    04012 ErbB signaling pathway     110473049 (NRAS)    04370 VEGF signaling pathway     110473049 (NRAS)    04371 Apelin signaling pathway     110473049 (NRAS)    04068 FoxO signaling pathway     110473049 (NRAS)    04150 mTOR signaling pathway     110473049 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     110473049 (NRAS)    04137 Mitophagy - animal     110473049 (NRAS)   09143 Cell growth and death    04210 Apoptosis     110473049 (NRAS)    04218 Cellular senescence     110473049 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     110473049 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     110473049 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     110473049 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     110473049 (NRAS)    04912 GnRH signaling pathway     110473049 (NRAS)    04916 Melanogenesis     110473049 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lsr04131]     110473049 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lsr04147]     110473049 (NRAS)    04031 GTP-binding proteins [BR:lsr04031]     110473049 (NRAS) Membrane trafficking [BR:lsr04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     110473049 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     110473049 (NRAS) Exosome [BR:lsr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110473049 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    110473049 (NRAS)   Exosomal proteins of breast cancer cells    110473049 (NRAS)   Exosomal proteins of colorectal cancer cells    110473049 (NRAS) GTP-binding proteins [BR:lsr04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     110473049 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  110473049 NCBI-ProteinID:  XP_021390963 UniProt:  A0A218UKE7 LinkDB All DBs Position 26:6348560..6353332 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSEDGNQG CMGLSCLVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtggtgggcgccggcggcgtgggcaagagcgcgctgacc atccagctcatccagaaccacttcgtggacgagtacgaccccaccatcgaggactcgtac cgcaagcaggtggtgatcgatggcgagacgtgcctgctggacatcctggacacggcgggg caggaggagtacagcgccatgagggaccagtacatgaggacaggggagggcttcctctgc gtcttcgccatcaacaacagcaaatccttcgccgacatcaacctctacagagaacagatc aagagagtgaaggactcggatgacgtgcccatggtgctggtggggaacaagtgtgatctg cccacaagaacagtggacacaaaacaggcccaagaattggcaaaaagctacggaatcccc ttcatagagacctctgcaaaaacgagacagggtgtggaagatgctttttacaccctggtg agggagatccggcagtaccggatgaagaagctcaacagcagcgaggatgggaaccagggc tgcatgggactgtcctgccttgtcatgtga

DBGET integrated database retrieval system