Lonchura striata (white-rumped munia): 110479063 Help Entry 110479063         CDS       T05897                                  Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism lsr  Lonchura striata (white-rumped munia) Pathway lsr04382   Cornified envelope formation lsr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lsr00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     110479063  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110479063  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lsr04147]     110479063 Exosome [BR:lsr04147]  Exosomal proteins   Exosomal proteins of microglial cells    110479063 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EFhand_Ca_insen DUF2065 HalOD1 Motif Other DBs NCBI-GeneID:  110479063 NCBI-ProteinID:  XP_021401772 LinkDB All DBs Position 25:1946084..1951329 Genome browser AA seq 97 aa AA seqDB search MPSQLEHAMETLMFTFHKYAGDKEHLAKEDLRALMDKEFPGFLENQRDPQALDRILRDVE QSRDGRVGFQGFFSLVAGLTIACNDYFVQHMKQRGRR NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtcgcagctggagcacgccatggagacgctgatgttcaccttccacaagtacgcg ggggacaaggagcacctggccaaggaggacctccgggcgctcatggacaaggagttcccc gggttcctcgagaaccagcgggacccccaggccctggatcgcatcctgcgggacgtggag cagagccgcgatggccgcgtcggcttccagggcttcttctcgctggtggccgggctgacc atcgcctgcaacgactacttcgtgcagcacatgaagcagcgcggccgccgctga

DBGET integrated database retrieval system