KEGG   Lonchura striata domestica (Bengalese finch): 110479729
Entry
110479729         CDS       T05897                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
lsr  Lonchura striata domestica (Bengalese finch)
Pathway
lsr04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:lsr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110479729 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:lsr04050]
    110479729 (TNFRSF8)
   04090 CD molecules [BR:lsr04090]
    110479729 (TNFRSF8)
Cytokine receptors [BR:lsr04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   110479729 (TNFRSF8)
CD molecules [BR:lsr04090]
 Proteins
  110479729 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6 PA_decarbox
Other DBs
NCBI-GeneID: 110479729
NCBI-ProteinID: XP_031362494
LinkDB
Position
21:1561765..1578560
AA seq 480 aa
MAACSLPLLLLLLQDVQTTQQTSLSPRHSCDTLENWFYDETSQNCCYQCPSGYVKKKACP
QNPAEDCMTCGPDQYLSNKSQKPQCDACVSCPKELDLVEKQPCSFNSSRVCECRPGLFCQ
LQVVDSCSRCQPHSACRPGFGVKGRGTATKDVTCEECPPGTFSDQNSSTDICKPHTNCAK
LNKVILRKGNATHDQVCLDQLPTYLTPSTLSVRFSNETNDFDLRMFKDNLVTSASGDLLS
ATTTENPSSTPEEKAGTSPTSAKGEMTTGGVVLWAVVLSVAVLLGGTLAFWKWKVCKKRI
LVLRRKPHLHSVIAHKYVLKSQGSDLVNKCAKIILTTDSGLEEEELIDRALPLETNNNLV
SSTEKAQSAHRGVTDVTPSTGNAPDCPVDSRVRDHTNNRIEKLYIMKADTVIVGSVSEVP
SGKNCALKGCESNDAQESMEEELEMHYPEQETESFPGNDVMVPVEEEGKEFHHPTTATEK
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggctgcctgcagcctgcctctgctcctgctgctgctccaggacgtccagacaacccaa
cagacctcattaagcccacgccattcctgtgatacactagagaactggttctatgatgaa
acttcacaaaactgctgttaccagtgtccctcaggctatgttaaaaagaaagcatgtcct
cagaatccagctgaagactgcatgacatgtggacctgatcagtatttgagcaataaatcc
caaaagccacaatgtgatgcctgtgtgtcatgcccaaaagagctggacctggtggagaag
cagccctgctccttcaattccagccgcgtgtgcgagtgccggccggggctgttctgccag
ctgcaggtggtggacagctgctcgcgctgccagccccactctgcctgcaggcctggcttc
ggcgtcaaaggcaggggcaccgcgacaaaagatgtcacttgtgaagagtgccctcctggg
accttctcggatcaaaactccagcacagacatctgcaaaccccacaccaactgtgccaag
ttgaacaaagtaatactaaggaaaggaaatgctacccatgatcaagtttgcctggaccag
ttgcccacttacctcaccccaagcactttgtccgtgagattcagcaatgaaacaaatgac
tttgacctgaggatgtttaaggacaacctggtgacctctgctagtggtgaccttctaagt
gccacaacaactgaaaaccccagttcaactcctgaggagaaagctggcacttctcccacc
tcagccaagggggagatgacaacaggaggtgtcgtgctttgggcagtggttctctctgtg
gcagtgcttcttgggggcacgctggcattttggaaatggaaggtttgcaagaagcggatc
ctcgtcctcaggaggaagccacacctgcattcggtcatcgcacacaaatacgtgctcaag
tctcaaggttcagatctcgtgaacaaatgtgcaaagatcatactgaccactgacagtggg
ctagaagaggaggagttaattgacagagcccttcctttggaaaccaacaataacttggtg
tccagcacagaaaaagcccagagtgctcatcggggtgtgactgatgtgacaccaagcact
gggaatgccccagactgccctgtggattctcgagtcagagaccacacaaataacagaatt
gaaaaactctacatcatgaaggccgacactgttatcgtgggctctgtttcagaagtgccc
agtggcaagaactgtgctcttaaaggatgtgagagtaacgatgcccaggaaagcatggaa
gaagaattggaaatgcactacccagagcaggaaacagagtcttttccagggaatgatgta
atggttcctgtggaagaggagggaaaggaatttcaccaccctaccactgccactgagaag
tga

DBGET integrated database retrieval system