Lonchura striata (white-rumped munia): 110480142 Help Entry 110480142         CDS       T05897                                  Symbol CALML4 Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism lsr  Lonchura striata (white-rumped munia) Pathway lsr04020   Calcium signaling pathway lsr04070   Phosphatidylinositol signaling system lsr04114   Oocyte meiosis lsr04218   Cellular senescence lsr04261   Adrenergic signaling in cardiomyocytes lsr04270   Vascular smooth muscle contraction lsr04371   Apelin signaling pathway lsr04625   C-type lectin receptor signaling pathway lsr04744   Phototransduction lsr04910   Insulin signaling pathway lsr04912   GnRH signaling pathway lsr04916   Melanogenesis Brite KEGG Orthology (KO) [BR:lsr00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     110480142 (CALML4)    04020 Calcium signaling pathway     110480142 (CALML4)    04070 Phosphatidylinositol signaling system     110480142 (CALML4)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     110480142 (CALML4)    04218 Cellular senescence     110480142 (CALML4)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     110480142 (CALML4)   09152 Endocrine system    04910 Insulin signaling pathway     110480142 (CALML4)    04912 GnRH signaling pathway     110480142 (CALML4)    04916 Melanogenesis     110480142 (CALML4)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     110480142 (CALML4)    04270 Vascular smooth muscle contraction     110480142 (CALML4)   09157 Sensory system    04744 Phototransduction     110480142 (CALML4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:lsr01009]     110480142 (CALML4)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lsr04131]     110480142 (CALML4)    03036 Chromosome and associated proteins [BR:lsr03036]     110480142 (CALML4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lsr04147]     110480142 (CALML4) Protein phosphatases and associated proteins [BR:lsr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      110480142 (CALML4) Membrane trafficking [BR:lsr04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     110480142 (CALML4) Chromosome and associated proteins [BR:lsr03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      110480142 (CALML4) Exosome [BR:lsr04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    110480142 (CALML4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_6 Motif Other DBs NCBI-GeneID:  110480142 NCBI-ProteinID:  XP_021403573 LinkDB All DBs Position 10:complement(19890740..19905448) Genome browser AA seq 92 aa AA seqDB search MRCLGVSPTPGEVQRHLQLHRIDKNAELDFSTFLNIMYRQMKQEEPEEEILRALAMLDRQ KRGVISVPELRAKLTRLGEKLSEEEGHSSAGI NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcgctgcctcggcgtcagccccacgcccggggaggtgcagaggcacctgcagctgcac aggatcgacaagaacgcagagctggacttctccaccttcctgaacatcatgtacaggcag atgaagcaggaggagcccgaggaggagatcctgagggccctggccatgctggacaggcag aagagaggagtgatctccgtgcccgagctccgcgccaagctcacccgcctgggcgagaag ctctccgaggaggaaggtcattcctcagctgggatttga

DBGET integrated database retrieval system