Lonchura striata (white-rumped munia): 110484164 Help Entry 110484164         CDS       T05897                                  Symbol CCL19 Name (RefSeq) C-C motif chemokine 19   KO K05512   C-C motif chemokine 19 Organism lsr  Lonchura striata (white-rumped munia) Pathway lsr04060   Cytokine-cytokine receptor interaction Brite KEGG Orthology (KO) [BR:lsr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110484164 (CCL19)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lsr04052]     110484164 (CCL19) Cytokines and neuropeptides [BR:lsr04052]  Cytokines   Chemokines    110484164 (CCL19) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 PRRT3 DUF3339 Motif Other DBs NCBI-GeneID:  110484164 NCBI-ProteinID:  XP_031363337 LinkDB All DBs Position Z:complement(34037942..34040163) Genome browser AA seq 95 aa AA seqDB search MQRVHLLCFSLLLPGCILDVHGRSNVLDCCLRTSEVPIPWWIVQDYWLQLVQDGCDIDAA VFITTKGKCLCAPLHSPWVIRLQKRLDATFAKRGK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgcagcgggtccatcttctctgcttcagtctcctgttgccgggatgtatcctggatgtg cacggcaggagcaacgtcctcgactgctgcctgcggacaagcgaggtgcccatcccatgg tggatcgtgcaggattactggctccagctggtgcaggatggctgtgacatcgatgctgcc gtattcatcaccacaaagggcaaatgcctctgtgcacccctccattccccgtgggtgatt cgtctccaaaagaggctggatgccacctttgccaagaggggcaagtag

DBGET integrated database retrieval system