Ligilactobacillus saerimneri: GTO87_03905 Help Entry GTO87_03905       CDS       T08336                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lsw  Ligilactobacillus saerimneri Pathway lsw01100   Metabolic pathways lsw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lsw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GTO87_03905 (acpP)    00074 Mycolic acid biosynthesis     GTO87_03905 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GTO87_03905 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Cadherin DUF3206 Motif Other DBs NCBI-ProteinID:  QLL77821 UniProt:  A0A7H9EJN3 LinkDB All DBs Position 756239..756481 Genome browser AA seq 80 aa AA seqDB search MTEQEVFTKIAALIEKHFNIATDKITNELNFQTDLDADSIDKVEFVLELEDEFGAEISDE DAEKLATVGDAVQYILAHQN NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgactgaacaagaagtatttacgaagatcgcggcattgattgaaaagcacttcaatatt gccacagataaaattaccaacgagcttaattttcaaactgatttagatgcggattcaatc gataaagttgaatttgtgttagagttagaagatgagtttggggcggaaatttctgacgag gatgcagaaaagcttgccacagttggcgatgcggttcaatatattttagcgcaccaaaac taa

DBGET integrated database retrieval system