Agrilutibacter terrestris: H8B22_01865 Help Entry H8B22_01865       CDS       T07218                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lsx  Agrilutibacter terrestris Pathway lsx01100   Metabolic pathways lsx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lsx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H8B22_01865 (acpP)    00074 Mycolic acid biosynthesis     H8B22_01865 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H8B22_01865 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  QNP41016 UniProt:  A0A7H0FYA0 LinkDB All DBs Position complement(402718..402957) Genome browser AA seq 79 aa AA seqDB search MSSIEERVKKIVVEQLGVKEDEVTNNASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITSVQQAIDYIKAHVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcagcatcgaagagcgcgtcaagaagatcgtcgtcgaacaactcggcgtgaaggaa gatgaagtcaccaacaacgcttcgttcgtcgacgacctcggcgcggactcgctcgacacc gtcgagctggtgatggccctcgaagaagagttcgagtgcgaaatcccggacgaggaagcc gagaagatcacctcggtgcagcaggccatcgactacatcaaggcgcacgtcaaggcctga

DBGET integrated database retrieval system