Agrilutibacter terrestris: H8B22_04835 Help Entry H8B22_04835       CDS       T07218                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism lsx  Agrilutibacter terrestris Pathway lsx00290   Valine, leucine and isoleucine biosynthesis lsx00650   Butanoate metabolism lsx00660   C5-Branched dibasic acid metabolism lsx00770   Pantothenate and CoA biosynthesis lsx01100   Metabolic pathways lsx01110   Biosynthesis of secondary metabolites lsx01210   2-Oxocarboxylic acid metabolism lsx01230   Biosynthesis of amino acids Module lsx_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine lsx_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:lsx00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     H8B22_04835    00660 C5-Branched dibasic acid metabolism     H8B22_04835   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     H8B22_04835   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     H8B22_04835 Enzymes [BR:lsx01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      H8B22_04835 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 DUF3710 ACT_AHAS_ss Motif Other DBs NCBI-ProteinID:  QNP41539 UniProt:  A0A7H0FZS3 LinkDB All DBs Position 1037323..1037559 Genome browser AA seq 78 aa AA seqDB search MHYQLDLTLRHAEGALARVLGTAERRGFQPISVDGEAQPDGDRWHLRMTVEGERAPESLQ QQLAKLYDCLAVEVSPCR NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgcactaccagcttgatctcaccctgcgccatgccgaaggtgccctcgcccgcgtactg ggcaccgccgaacgccgcggcttccagccgatcagcgtcgatggcgaagcgcaacccgac ggcgaccgctggcacctgcgtatgaccgtcgagggcgagcgcgcgcccgaatcgctgcag cagcagctggcgaagctgtacgactgcctcgcggtggaggtgtcgccgtgtcgctga

DBGET integrated database retrieval system