Agrilutibacter terrestris: H8B22_08355 Help Entry H8B22_08355       CDS       T07218                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lsx  Agrilutibacter terrestris Pathway lsx01100   Metabolic pathways lsx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lsx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H8B22_08355    00074 Mycolic acid biosynthesis     H8B22_08355   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H8B22_08355 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QNP39543 UniProt:  A0A7H0FU27 LinkDB All DBs Position 1796463..1796747 Genome browser AA seq 94 aa AA seqDB search MSEANATAQTAAEAELAKLLVDSLNLEGVAPADIDPDARLFGEGLGLDSIDALELALAVS KQYGFQLRSDNDENRRIFASLRALSAHIEQNRAA NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgtccgaagccaacgccaccgcccagaccgccgccgaagccgaactggccaagctgctg gtggacagcctgaacctggaaggcgtcgcgccggccgatatcgatcccgatgcgcgcctg ttcggcgagggcctgggcctggattccatcgacgcgctcgaactggcgctggcggtgtcg aagcagtacggcttccagctgcgttcggacaacgacgagaaccggcgcatcttcgcctcg ctgcgcgcgctgtcggcgcacatcgagcagaaccgcgcggcctga

DBGET integrated database retrieval system