Leptotrichia shahii: JCM16776_0145 Help Entry JCM16776_0145     CDS       T06589                                  Symbol tufB Name (GenBank) elongation factor Tu 2   KO K02358   elongation factor Tu Organism lsz  Leptotrichia shahii Brite KEGG Orthology (KO) [BR:lsz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03012 Translation factors [BR:lsz03012]     JCM16776_0145 (tufB)    03029 Mitochondrial biogenesis [BR:lsz03029]     JCM16776_0145 (tufB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lsz04147]     JCM16776_0145 (tufB) Translation factors [BR:lsz03012]  Eukaryotic type   Elongation factors    JCM16776_0145 (tufB)  Prokaryotic type    JCM16776_0145 (tufB) Mitochondrial biogenesis [BR:lsz03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial transcription and translation factors    Mitochondrial translation factors     JCM16776_0145 (tufB) Exosome [BR:lsz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    JCM16776_0145 (tufB)   Exosomal proteins of breast cancer cells    JCM16776_0145 (tufB)   Exosomal proteins of colorectal cancer cells    JCM16776_0145 (tufB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GTP_EFTU_D3 GTP-eEF1A_C Motif Other DBs NCBI-ProteinID:  BBM39942 UniProt:  A0A510JKV6 LinkDB All DBs Position 164018..164269 Genome browser AA seq 83 aa AA seqDB search MTKDEGGRHTPFFTGYKPQFYFRTTDITGEVNLPEGVEMVMPGDNIEMTVELIHPIAMEE GLRFAIREGGRTVASGVVATITK NT seq 252 nt NT seq  +upstreamnt  +downstreamnt ttgacaaaagatgaaggaggaagacatacaccattcttcacaggatacaagccacaattc tacttcagaacgactgacattacaggagaagtaaacttgccagaaggagtagaaatggta atgcctggagacaacatagaaatgacagtggaactaattcacccaatcgcaatggaagaa ggattaagatttgcgataagagaaggtggaagaacagtagcttcaggggtagttgcaact attactaagtag

DBGET integrated database retrieval system