Leptotrichia shahii: JCM16776_0871 Help Entry JCM16776_0871     CDS       T06589                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lsz  Leptotrichia shahii Pathway lsz01100   Metabolic pathways lsz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lsz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JCM16776_0871    00074 Mycolic acid biosynthesis     JCM16776_0871   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JCM16776_0871 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF3970 DUF1493 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  BBM40651 UniProt:  A0A510JQD9 LinkDB All DBs Position 930039..930263 Genome browser AA seq 74 aa AA seqDB search MLDKIKSIVVDQLGVDEDQVTEDASFVDDLGADSLDTVELIMAFEEEFDIEIPDEDAQKI KTVKDVMEYIEAKQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgctagataaaattaaatcaatagttgtagatcaattaggtgtagatgaggatcaagta actgaagatgcatcttttgttgatgatttaggagctgattcattggatacagttgaatta atcatggcttttgaagaagaatttgatattgaaattcctgatgaagatgcacaaaaaatt aaaactgttaaagatgtaatggaatacatcgaagctaaacaataa

DBGET integrated database retrieval system