Leptotrichia trevisanii: JMUB4039_0879 Help Entry JMUB4039_0879     CDS       T06733                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lte  Leptotrichia trevisanii Pathway lte01100   Metabolic pathways lte01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lte00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JMUB4039_0879    00074 Mycolic acid biosynthesis     JMUB4039_0879   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JMUB4039_0879 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1493 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  BBM56901 LinkDB All DBs Position 924556..924777 Genome browser AA seq 73 aa AA seqDB search MLDKIKSIVVDQLGVDEDQVTEDASFVDDLGADSLDTVELIMAFEEEFDIEIPDEDAQKI KTVKDVIEYIESK NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgctagataaaattaaatcaatagtagtagatcaattaggagtagacgaagatcaagta acagaagatgcgtctttcgttgatgatttaggagctgattcattagacacagttgagtta atcatggcttttgaagaagaattcgacattgaaattcctgatgaggatgcacaaaaaatt aaaacagttaaagatgtaatcgaatatatcgaatctaaataa

DBGET integrated database retrieval system