Lachancea thermotolerans: KLTH0A06820g Help Entry KLTH0A06820g      CDS       T01117                                  Name (RefSeq) ubiquitin-like protein HUB1   KO K13113   ubiquitin-like protein 5 Organism lth  Lachancea thermotolerans Brite KEGG Orthology (KO) [BR:lth00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:lth03041]     KLTH0A06820g   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lth04052]     KLTH0A06820g Spliceosome [BR:lth03041]  Complex B   Other components    Complex B specific factors     KLTH0A06820g Cytokines and neuropeptides [BR:lth04052]  Neuropeptides   Unclassified    KLTH0A06820g BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD RAWUL EstA_Ig_like Motif Other DBs NCBI-GeneID:  8290561 NCBI-ProteinID:  XP_002551754 UniProt:  C5DC05 LinkDB All DBs Position A:complement(569895..570116) Genome browser AA seq 73 aa AA seqDB search MIEVEVNDRLGKKIRVKCEGEDTVGDFKKVLALQLGISWTKIVLQKGGAVLKDHITLDDY EVHDQTYLELYYL NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaagtcgaggtcaatgatcgattaggaaagaagatccgagtcaagtgcgaaggc gaggatactgttggtgatttcaagaaagtgttagcgcttcagttgggtatttcatggact aagattgtgttgcaaaagggaggagcagtgcttaaagaccacatcacgcttgatgactat gaggttcatgatcaaacgtatttggaactgtactatctttaa

DBGET integrated database retrieval system