Lachancea thermotolerans: KLTH0E02244g Help Entry KLTH0E02244g      CDS       T01117                                  Name (RefSeq) KLTH0E02244p   KO K12416   anaphase-promoting complex subunit SWM1 Organism lth  Lachancea thermotolerans Pathway lth04111   Cell cycle - yeast lth04113   Meiosis - yeast lth04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:lth00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     KLTH0E02244g  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     KLTH0E02244g    04113 Meiosis - yeast     KLTH0E02244g  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:lth04121]     KLTH0E02244g    03036 Chromosome and associated proteins [BR:lth03036]     KLTH0E02244g Ubiquitin system [BR:lth04121]  Ubiquitin ligases (E3)   Multi subunit type E3    APC/C     Other subunits      KLTH0E02244g Chromosome and associated proteins [BR:lth03036]  Eukaryotic type   Sister chromatid separation proteins    APC/C complex     KLTH0E02244g BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Apc13p Motif Other DBs NCBI-GeneID:  8291726 NCBI-ProteinID:  XP_002553587 UniProt:  C5DH89 LinkDB All DBs Position E:complement(200939..201328) Genome browser AA seq 129 aa AA seqDB search MYRDSHFQSHHMLRSHHVLYLDWNNDVFTAPDQPVSNAPRAGSSALPINPFWDYFHDDDD WDRFHPLQVDCSGQLTAMPPLVPTPTALGSLFAPRRAELGAWRDTGDLTSADLADRDPDA QAQGQGPDA NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtaccgcgactcccacttccagagccaccacatgctgcgctcgcaccacgtgctctat ctcgactggaacaacgacgtcttcaccgcgcctgaccagccggtctccaacgccccgcgt gcgggctcctccgccctgcccatcaaccccttctgggactacttccacgacgacgacgac tgggaccgcttccacccgctgcaggtcgactgctccggtcagctgaccgccatgccgccg ctggtccccacgcctaccgccctgggctcgctcttcgcaccgcgccgcgccgagctcggc gcctggcgcgacaccggcgacctcacgtcagctgaccttgccgaccgcgaccccgacgct caagcccagggccagggccccgacgcgtga

DBGET integrated database retrieval system