Lachancea thermotolerans: KLTH0G15642g Help Entry KLTH0G15642g      CDS       T01117                                  Name (RefSeq) KLTH0G15642p   KO K11511   centromere protein S Organism lth  Lachancea thermotolerans Pathway lth03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:lth00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     KLTH0G15642g  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lth03036]     KLTH0G15642g    03400 DNA repair and recombination proteins [BR:lth03400]     KLTH0G15642g Chromosome and associated proteins [BR:lth03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      KLTH0G15642g DNA repair and recombination proteins [BR:lth03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      KLTH0G15642g BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C TFIID-31kDa Motif Other DBs NCBI-GeneID:  8293999 NCBI-ProteinID:  XP_002555713 UniProt:  C5DNB5 LinkDB All DBs Position G:1366294..1366650 Genome browser AA seq 118 aa AA seqDB search MSEQNSTSDSHMSEEQKQQLIPQLKGKLWYCLEQLVKKELPSDISYSPKFINALVELCFT QLVDIGGDLEAFARHAGRETIVVEDLMLRLRNSSDLQQLLQQKLEENTAVGPARRADR NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgagtgagcaaaatagtacaagtgatagccatatgtctgaggaacaaaagcagcaacta attcctcaattgaaaggaaagctctggtattgtctggagcagctggtaaagaaagagtta ccaagcgatatcagctactcacctaaattcataaacgcgcttgtagagttgtgcttcacc caactggtggatatcggcggtgatcttgaagccttcgcaagacatgcggggcgggagaca atagtggtcgaggacctaatgctgaggctgcggaactcaagcgatttgcagcaattgctc cagcagaaactggaagaaaatacagcagtggggccagcacgtagggcggataggtga

DBGET integrated database retrieval system