Limnobacter thiooxidans: RGQ30_01840 Help Entry RGQ30_01840       CDS       T09704                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism lto  Limnobacter thiooxidans Brite KEGG Orthology (KO) [BR:lto00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:lto03110]     RGQ30_01840 (grxC) Chaperones and folding catalysts [BR:lto03110]  Protein folding catalysts   Protein disulfide isomerase    RGQ30_01840 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 DSBA Thioredoxin_3 Motif Other DBs NCBI-ProteinID:  BET24683 UniProt:  A0AA86IZB3 LinkDB All DBs Position 201085..201360 Genome browser AA seq 91 aa AA seqDB search MSSQQAPVRMYTSAVCPYCMRAERLLNERGVQNIEKIRVDLDPSQKEKMMAETGRRTVPQ IYIGSTHVGGCDDLHDLDRAGKLLPLLNQAG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagcagtcaacaggcccctgtccgcatgtacaccagcgccgtatgcccttattgcatg cgcgcagaacgtttgttgaatgaacgtggtgtgcagaacattgagaaaatccgggttgat ctggaccccagccaaaaagaaaaaatgatggctgaaacaggtcgccgcaccgtgccgcaa atctatattggcagcacgcatgtgggtggttgtgacgacctgcacgacctggaccgcgct ggcaaactgttgccattgttgaaccaggctggctaa

DBGET integrated database retrieval system