Lachnoanaerobaculum umeaense: D4A81_11675 Help Entry D4A81_11675       CDS       T05639                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lua  Lachnoanaerobaculum umeaense Pathway lua01100   Metabolic pathways lua01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lua00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D4A81_11675 (acpP)    00074 Mycolic acid biosynthesis     D4A81_11675 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D4A81_11675 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Phage_T7_Gp5_9 DUF1493 Baculo_19 Motif Other DBs NCBI-ProteinID:  AYB00521 UniProt:  A0A385Q2C9 LinkDB All DBs Position complement(2490934..2491170) Genome browser AA seq 78 aa AA seqDB search MSEKMKSIIAEQLNIDAAEITLESSFKDDLNADSLDLFEMVMALEDNYGVEIPSEDLEKL LTVGDVVNYLKDKGVDNL NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcagagaaaatgaaatcaattattgcagagcagttaaatatcgatgcagctgaaatc acattggagtcaagcttcaaggatgatttgaatgcagattcacttgacctatttgaaatg gtaatggcacttgaggacaattatggtgttgagataccatctgaggatttagagaagctt ttgactgtaggtgatgtagtaaattaccttaaggacaaaggtgtagataatttataa

DBGET integrated database retrieval system